Genomics and proteomics search results

CCL4 oAb (clone C4HCLC), ABfinity™ recombinant (Novex®)

This purified oligoclonal recombinant rabbit IgG antibody recognizes CCL4. ...

Specifications

Reactivity
Mouse
Validated Application
Western Blot
Host
Rabbit
SubClass (Isotype)
IgG1
Clonality
Polyclonal
Clone ID
C4HCLC
Antibody Fragment
Whole Antibody
Gene ID
6351
Gene Symbol
CCL4
Accession Number
P13236
Label or Dye
Unconjugated
Purification
Purified
Concentration
0.5 mg⁄ml
Color
Unconjugated
Neutralizing Antibody
No
Protein Family
Chemokines & Receptors
Comments
Oligoclonal (Pool of Monoclonal Abs to Several Epitopes)
Shipping Condition
Approved for shipment on Wet or Dry Ice
Regulatory Statement
For Research Use Only. Not for use in diagnostic procedures.

Related Applications

710016
32577c42e59ecd3a900ba200c9ee5c80_CmgtBuyProduct

CCL4 Antibody (Thermo Scientific™)

A suggested positive control is rat brain tissue lysate. PA5-34509 can be used with blocking peptide PEP-1552. ...

Specifications

Regulatory Statement
For Research Use Only. Not for use in diagnostic procedures.
PA534509
f1bf5b10c80a6f4b5d14ecf159470a6d_CmgtBuyProduct

CCL4 Antibody (Thermo Scientific™)

Specifications

Regulatory Statement
For Research Use Only. Not for use in diagnostic procedures.
PA523681
bf543a3d2d2ad9286a0a0cbfdd499233_CmgtBuyProduct

CCL4 Antibody (Thermo Scientific™)

PA1-28319 detects CCL4 from human samples. PA1-28319 has been successfully used in Western blot applications. The PA1-28319 immunogen is: Synthetic peptide: GSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLELN, corresponding to amino acids 27-92 of Human Macro ...

Specifications

Regulatory Statement
For Research Use Only. Not for use in diagnostic procedures.
ec8e30a3780b93eb22679120988e6346_CmgtBuyProduct

CCL4 Antibody (Thermo Scientific™)

PA1-29036 detects CCL4 from mouse, rat samples. PA1-29036 has been successfully used in immunoprecipitation, Western blot applications. The PA1-29036 immunogen is: Recombinant protein - amino acids 1-69 of mature rat CCL4 ...

Specifications

Regulatory Statement
For Research Use Only. Not for use in diagnostic procedures.
PA129036
3ba4aaad02fd3635357650bc2c43f67a_CmgtBuyProduct

MIP-1β Human Singleplex Bead Kit (Novex®)

This Singleplex bead kit comprises the analyte specific components for the measurement of human MIP-1β (Marcophage Inflammatory Protein-1 beta) in serum, plasma or tissue culture supernatant. The assay may be run alone or in combination with other Human Singleplex Bead Kits from ...

Specifications

Marker
MIP-1β⁄CCL4
System
Luminex®
Gene ID
20303
Species
Human
Platform
Luminex® Instruments
Bead Type
Polystyrene
Bead Region
28
Gene Symbol
Ccl4
Sensitivity
<10 pg/ml
Target Gene
chemokine (C-C motif) ligand 4
Gene Aliases
AT744.1, Act-2, MIP-1B, Mip1b, Scya4
Label or Dye
R-PE
Protein Family
Chemokines & Receptors
Accession Number
NM_013652.2
NP_038680.1
Detection Method
Fluorescent
Research Category
Immunology
Sample Type (Specific)
Plasma
Serum
Cell Culture Supernatants
Shipping Condition
Wet Ice
Regulatory Statement
For Research Use Only. Not for use in diagnostic procedures.

Related Applications

LHC1051
030001d1d6b19347246e3ef56e949885_CmgtBuyProduct

Chemokine Human 5-Plex Panel (Novex®)

The Chemokine Human 5-Plex Panel for the Luminex® platform is specifically designed for quantifying human Eotaxin, MIP-1α, MIP-1β, MCP-1, and RANTES in serum, plasma, and tissue culture supernatant. By measuring 5 analytes simultaneously, the Luminex® assay panel helps provide mo ...

Specifications

Marker
MIP-1α
Eotaxin
MCP-1
MIP-1β
RANTES
System
Luminex®
Gene ID
6347, 6348, 6351, 6352, 6356
Species
Human
Platform
Luminex® Instruments
Bead Type
Polystyrene
Bead Region
See Product Insert
Gene Symbol
CCL2
CCL5
CCL11
CCL3
CCL4
Sensitivity
See Product Insert
Label or Dye
R-PE
Protein Family
Chemokines & Receptors
Detection Method
Fluorescent
Research Category
Immunology
Sample Type (Specific)
Plasma
Serum
Cell Culture Supernatants
Shipping Condition
Wet Ice
Regulatory Statement
For Research Use Only. Not for use in diagnostic procedures.

Related Applications

LHC0005
1c951813fbe11897ec974729b1e11e00_CmgtBuyProduct

MIP-1-beta Recombinant Human Protein (Gibco®)

Recombinant MIP-1-beta is a bioactive protein intended for use in cell culture applications. MIP-1-beta (Macrophage inflammatory protein-1α) is involved in a number of biological processes including chemotaxis and is involved in inducing the synthesis of pro-inflammatory cytokin ...

Specifications

Form
Liquid
Purity
95 %
Gene ID
6351
Species
Human
Expression
E. coli
Gene Aliases
MIP-1β
Protein Form
Recombinant
Ligand
Purification
Sequential Chromatography
Protein Family
Chemokines & Receptors
Endotoxin Level
< 0.1 ng/µg
Protein Subtype
MIP (Macrophage Inflammatory Protein) Chemokines
Molecular Weight
8 kDa
Research Category
Immunology
Inflammation
Virology
Neurobiology
Validated Application
Cell Culture
Purity or Quality Grade
Carrier-Free
Shipping Condition
Dry Ice
Regulatory Statement
For Research Use Only. Not for use in diagnostic procedures.

Related Applications

PHC1033L
b4cdef5c72ed545074b5fc77534f349b_CmgtBuyProduct

Cytokine Human Magnetic 25-Plex Panel (Novex®)

The Cytokine Human Magnetic 25-Plex Panel for the Luminex® platform is specifically designed for quantifying human cytokines and chemokines in serum, plasma, and tissue culture supernatant. By measuring 25 analytes simultaneously, the Luminex® assay panel helps provide more data ...

Specifications

Marker
GM-CSF
TNF-α
IL-4
IL-6
MIP-1α
IL-8
MIG
MCP-1
IL-7
IL-15
IFN-α
IL-2R
IP-10
MIP-1β
Eotaxin
RANTES
IL-1RA
IFN-γ
IL-13
IL-12 (p40⁄p70)
IL-17
IL-10
IL-5
IL-2
IL-1β
Gene ID
3600, 3605, 7124, 3439, 3458, 12981, 6348, 6351, 3627, 4283, 6356, 6352, 6347
3553, 3554, 3558, 3559, 3565, 3567, 3569, 3574, 3576, 3586, 3593, 3596
Species
Human
Bead Type
Magnetic
Gene Symbol
CCL2
IFNA1
IL1B
CCL5
IL6
TNF
IL2
IL10
IL13
IL12B
IFNG
IL8
CXCL9
CCL3
IL4
CCL4
Csf2
CXCL10
IL17A
CCL11
IL7
IL15
IL1R1
IL2RA
IL5
Label or Dye
R-PE
Protein Family
Cytokines & Receptors
Detection Method
Fluorescent
Research Category
Immunology
Sample Type (Specific)
Plasma
Cell Culture Supernatants
Serum
Shipping Condition
Wet Ice
Regulatory Statement
For Research Use Only. Not for use in diagnostic procedures.

Related Applications

LHC0009M
390a30ac1f65d5f4fb901f32ae5ac39c_CmgtBuyProduct

MIP-1β Human ELISA Kit (Novex®)

The MIP-1β Human ELISA Kit is designed to quantify protein levels of human MIP-1β in serum, plasma, supernatant, and other biological fluids. MIP-1β is part of the chemokine superfamily. ...

Specifications

Marker
MIP-1β
Gene ID
6351
Species
Human
Platform
Microplate Reader
Gene Symbol
CCL4
Sensitivity
2 pg/ml
Target Gene
chemokine (C-C motif) ligand 4
Gene Aliases
MIP-1-beta, MIP1B, MIP1B1, SCYA2, SCYA4
ACT2, AT744.1, G-26, HC21, LAG-1, LAG1, MGC104418, MGC126025, MGC126026
Label or Dye
HRP (Horseradish Peroxidase)
Concentration
15.6-1000 pg⁄ml
Sample Volume
50 µl
Protein Family
Chemokines & Receptors
Incubation Time
4 hrs
Accession Number
NM_002984.2
NP_002975.1
Detection Method
Colorimetric
Research Category
Immunology
Sample Type (Specific)
Plasma
Serum
Supernatants
Shipping Condition
Wet Ice
Regulatory Statement
For Research Use Only. Not for use in diagnostic procedures.

Related Applications

KAC2291
cf7d38d4a8eca53ed676e449f656b02f_CmgtBuyProduct

Chemokine Monkey 5-Plex Panel (Novex®)

The Chemokine Monkey 5-Plex Panel for the Luminex® platform is specifically designed for quantifying monkey IL-8, MCP-1, MIP-1α, MIP-1β and RANTES in serum, plasma, and tissue culture supernatant. By measuring 5 analytes simultaneously, the Luminex® assay panel helps provide more ...

Specifications

Marker
MIP-1α
IL-8
MCP-1
MIP-1β
RANTES
System
Luminex®
Gene ID
116637, 20302, 574138, 613028, 6352
Species
Monkey
Platform
Luminex® Instruments
Bead Type
Polystyrene
Bead Region
See Product Insert
Gene Symbol
CCL2
IL8
Ccl4
Ccl3
CCL5
Sensitivity
See Product Insert
Label or Dye
R-PE
Protein Family
Chemokines & Receptors
Detection Method
Fluorescent
Research Category
Immunology
Sample Type (Specific)
Plasma
Cell Culture Supernatants
Serum
Shipping Condition
Wet Ice
Regulatory Statement
For Research Use Only. Not for use in diagnostic procedures.

Related Applications

LPC0002
31a8b25d5c878f5e1fc1af2d36c1ddb1_CmgtBuyProduct

Cytokine Human Magnetic 30-Plex Panel (Novex®)

The Cytokine Human Magnetic 30-Plex Panel for the Luminex® platform is specifically designed for quantifying human cytokines, chemokines and growth factors in serum, plasma, and tissue culture supernatant. By measuring 30 analytes simultaneously, the Luminex® assay panel helps pr ...

Specifications

Marker
GM-CSF
TNF-α
IL-4
IL-6
MIP-1α
IL-8
HGF
IL-15
IFN-α
IL-2R
IP-10
MIP-1β
Eotaxin
RANTES
MIG
VEGF
IL-1RA
IL-12 (p40⁄p70) IL-13
FGF-Basic
IFN-γ
G-CSF
MCP-1
IL-7
EGF
IL-17
IL-10
IL-5
IL-2
IL-1β
Gene ID
1950, 6356, 2247, 1443, 12981, 3082, 3439, 3458, 3554, 3553, 3558, 3559, 3565, 3567, 3569
3574, 3576, 3586, 3593, 3596, 3600, 3605, 3627, 6347, 4283, 6348, 6351, 6352, 7124, 7422
Species
Human
Bead Type
Magnetic
Gene Symbol
EGF
TNF
CCL5
IL6
IFNA1
CCL2
IL1B
IL12B
IFNG
IL8
FGF2
CXCL9
CCL3
IL4
CCL4
IL2
Csf2
HGF
CSH2
CXCL10
IL17A
CCL11
IL7
IL15
IL1R1
IL2RA
IL5
VEGFA
IL10
IL13
Label or Dye
R-PE
Protein Family
Cytokines & Receptors
Detection Method
Fluorescent
Research Category
Immunology
Sample Type (Specific)
Plasma
Cell Culture Supernatants
Serum
Shipping Condition
Wet Ice
Regulatory Statement
For Research Use Only. Not for use in diagnostic procedures.

Related Applications

LHC6003M
ce607917fc240136108e5bd494ea47a2_CmgtBuyProduct

Cytokine Human 30-Plex Panel (Novex®)

The Cytokine Human 30-Plex Panel for the Luminex® platform is specifically designed for quantifying human cytokines, chemokines, and growth factors in serum, plasma, and tissue culture supernatant. By measuring 30 analytes simultaneously, the Luminex® assay panel helps provide mo ...

Specifications

Marker
GM-CSF
TNF-α
IL-1β
IL-4
IL-6
MIP-1α
IL-8
IL-2R
IP-10
MIP-1β
Eotaxin
RANTES
MIG
VEGF
HGF
EGF
IL-1RA
IL-12 (p40⁄p70) IL-13
FGF-Basic
IFN-γ
G-CSF
MCP-1
IL-7
IL-15
IFN-α
IL-17
IL-10
IL-5
IL-2
System
Luminex®
Gene ID
1437, 1440, 1950, 2246, 3082, 3438, 3458, 3552, 3553, 3558, 3562, 3565, 3567
6352, 6356, 7124, 7422
3569, 3574, 3576, 3586, 3592, 3596, 3600, 3605, 3627, 4283, 6347, 6348, 6351
Species
Human
Platform
Luminex® Instruments
Bead Type
Polystyrene
Bead Region
See Product Insert
Gene Symbol
EGF
CCL2
CCL5
IL6
TNF
CSF3
IL1A
IL8
CSF2
CXCL9
CCL3
IL12A
IL4
CCL4
IL2
IL1B
HGF
CXCL10
IL17A
CCL11
IL3
IL7
IL15
FGF1
IL5
VEGFA
IFN1@
IL10
IL13
IFNG
Sensitivity
See Product Insert
Label or Dye
R-PE
Protein Family
Cytokines & Receptors
Detection Method
Fluorescent
Research Category
Immunology
Sample Type (Specific)
Plasma
Cell Culture Supernatants
Serum
Shipping Condition
Wet Ice
Regulatory Statement
For Research Use Only. Not for use in diagnostic procedures.

Related Applications

LHC6003
63c6b005cfd223a823b698abc2b23fb1_CmgtBuyProduct

MIP-1β Human Antibody Pair (Novex®)

This Antibody Pair Kit comes with matched antibody pairs to detect and quantify protein levels of human MIP-1β (Marcophage Inflammatory Protein-1β). Also available is Buffer Kit for Antibody Pairs that saves time with premade, easy-to-use buffers and solutions optimized for use ...

Specifications

Form
Concentrated
Marker
MIP-1β⁄CCL4
Gene ID
6351
Platform
Microplate Reader
Reactivity
Human
Gene Symbol
CCL4
Target Gene
MIP-1β
Gene Aliases
MIP-1-beta, MIP1B, MIP1B1, SCYA2, SCYA4
ACT2, AT744.1, G-26, HC21, LAG-1, LAG1, MGC104418, MGC126025, MGC126026
Label or Dye
HRP (Horseradish Peroxidase)
Emission Class
Visible
Protein Family
Chemokines & Receptors
Target Molecule
Protein
Accession Number
NM_002984.2
NP_002975.1
Research Category
Immunology
Inflammation
Validated Application
ELISA
Shipping Condition
Wet Ice
Regulatory Statement
For Research Use Only. Not for use in diagnostic procedures.

Related Applications

CHC2293
91441f0dc9d5020b366e67c0349d62f9_CmgtBuyProduct

Cytokine Human 25-Plex Panel (Novex®)

The Cytokine Human 25-Plex Panel for the Luminex® platform is specifically designed for quantifying human cytokines and chemokines in serum, plasma, and tissue culture supernatant. By measuring 25 analytes simultaneously, the Luminex® assay panel helps provide more data from each ...

Specifications

Marker
GM-CSF
TNF-α
IL-1β
IL-4
IL-6
MIP-1α
IL-8
IL-15
IFN-α
IL-2R
IP-10
MIP-1β
Eotaxin
RANTES
MIG
IL-12 (p40⁄p70)
IL-1RA
IFN-γ
IL-13
MCP-1
IL-7
IL-17
IL-10
IL-5
IL-2
System
Luminex®
Gene ID
1437, 3438, 3458, 3552, 3553, 3558, 3562, 3565, 3567, 3569, 3574, 3576, 3586
3592, 3596, 3600, 3605, 3627, 4283, 6347, 6348, 6351, 6352, 6356, 7124
Species
Human
Platform
Luminex® Instruments
Bead Type
Polystyrene
Bead Region
See Product Insert
Gene Symbol
CCL2
IL6
IL1B
IL1A
CCL5
TNF
IL2
IL13
IFNG
IL8
CSF2
CXCL9
CCL3
IL12A
IL4
CCL4
CXCL10
IL17A
CCL11
IL3
IL7
IL15
IL5
IFN1@
IL10
Sensitivity
See Product Insert
Label or Dye
R-PE
Protein Family
Cytokines & Receptors
Detection Method
Fluorescent
Research Category
Immunology
Sample Type (Specific)
Plasma
Cell Culture Supernatants
Serum
Shipping Condition
Wet Ice
Regulatory Statement
For Research Use Only. Not for use in diagnostic procedures.

Related Applications

LHC0009
65d9c6d72b442f9b6e79af46d8ed7ee2_CmgtBuyProduct