Omnia® S/T Peptide 28 Kit

See all Kinase Assay Kits

Catalog # Unit Size List Price
KNZ1281 1 kit 930.00

Description

The Omnia® kinase assay utilizes peptide substrates incorporating the proprietary SOX moiety to measure phosphorylation in an antibody-free format. This enables the user to   View full product details >

General Specifications

Form
Frozen
Color
Green
Readout
Kinetic
Platform
Microplate Reader
Technique
Fluorescence Intensity
Assay Type
Serine⁄Threonine Kinase Assay
References
Nature Methods Vol 2 pps 277-283 (2005) and JACS Vol 125 pps 14248 - 14249 (2003)
Label or Dye
Sox Chelation-Enhanced Fluorophore
Product Size
1 kit
Target Enzyme
Serine/Threonine Kinases
Substrate Type
Kinase Substrate
Detection Method
Fluorescent
Molecular Weight
4941.1 Da
Amino Acid Sequence
Ac-(Sox)PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2
Substrate Properties
Peptide-Based Substrate
Excitation⁄Emission (nm)
360⁄485
Shipping Condition
Dry Ice
Regulatory Statement
For Research Use Only. Not for use in diagnostic procedures.

Product Applications

  • Drug Discovery & Development
  • Proteins, Expression, Isolation & Analysis
KNZ1281
6cb7498f34267ba48170d99a14ed7bf3_CmgtBuyProduct

Phosphoinositide-dependent Protein Kinase-1 (PDK-1) Rabbit anti-Human Polyclonal Antibody

See all Protein Specific Primary Antibodies

Catalog # Unit Size List Price
AHZ0512 50 µg 279.00

Description

ALPHA PDK-1 HU; Unconjugated Polyclonal antibody specific to Human PDK-1. This antibody is validated for use in Western Blot. Anti-PDK-1 recognizes the expressed product of the   View full product details >

General Specifications

Reactivity
Human
Validated Application
Western Blot
Host
Rabbit
SubClass (Isotype)
IgG
Clonality
Polyclonal
Target Gene
PDK-1
Gene ID
5163
Label or Dye
Unconjugated
Purification
Purified
Product Size
50 µg
Shipping Condition
Dry Ice
Regulatory Statement
For Research Use Only. Not for use in diagnostic procedures.

Product Applications

  • Drug Discovery & Development
  • Proteins, Expression, Isolation & Analysis
AHZ0512
63caf7bb4a79eea4aed30086c4256ed8_CmgtBuyProduct